PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008400P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 244aa    MW: 27286.1 Da    PI: 4.6934
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008400P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.53e-382886462
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +a +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++++
  MELO3C008400P1 28 TAPNCPRCASTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGSLRNVPVGGGCRKSRRAK 86
                    5679***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-251879IPR003851Zinc finger, Dof-type
PfamPF027011.7E-322984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7423084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSDHHQLPPP PPPFPSHLER KWKPHLETAP NCPRCASTNT KFCYYNNYSL SQPRYFCKSC  60
RRYWTKGGSL RNVPVGGGCR KSRRAKSSKS SPISRPSKPD LSSQTTDSSS SASDIDLAAV  120
FARFLNSEPQ ALTSSPESVD PLEISEIFLE GLSDLLLEDE NQREEGKQGI PGNHENVSFG  180
LETELGIDEE VWASQEMQEQ VQELDSFSCN YYANDLRVSD QLCQVGDNWS SFDFAAVNNV  240
EYF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818150.0LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441540.10.0PREDICTED: dof zinc finger protein DOF1.2
TrEMBLA0A0A0KGG21e-142A0A0A0KGG2_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s07150.14e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.14e-33Dof family protein